PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10001177
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family NF-YB
Protein Properties Length: 213aa    MW: 21919.1 Da    PI: 6.9171
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10001177genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB186.32.2e-5822117297
        NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                  reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yveplk+yl+kyre+egek
  Lus10001177  22 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKAYLQKYREMEGEK 117
                  89********************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.6E-5518125IPR009072Histone-fold
SuperFamilySSF471133.73E-4124126IPR009072Histone-fold
PfamPF008086.5E-282791IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006159.9E-225573No hitNo description
PROSITE patternPS0068505874IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006159.9E-227492No hitNo description
PRINTSPR006159.9E-2293111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MADSDNESGG HGGGGHGELS AREQDRFLPI ANVSRIMKKA LPANAKISKD AKETVQECVS  60
EFISFITGEA SDKCQREKRK TINGDDLLWA MTTLGFEEYV EPLKAYLQKY REMEGEKSPM  120
GGGVSREKDG GDGATGAGGS SGGVNSGGGM GSSSSGGGGG GGMYGGMMMM GHHQGQVYGS  180
SGFQHPHQQH HHHHQMGVGK GGAGGGATST TR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B4e-4919112194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A4e-4919112194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004305679.11e-87PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233102e-76NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLD7UAG54e-86D7UAG5_VITVI; Putative uncharacterized protein
STRINGVIT_19s0015g00440.t011e-85(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.17e-70nuclear factor Y, subunit B3